SCOP 1.75: Domain d2gj6e2: 2gj6 E:118-246

Lineage for d2gj6e2 (2gj6 E:118-246)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein T-cell antigen receptor [49125] (6 species)

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (28 PDB entries)

8. Domain d2gj6e2: 2gj6 E:118-246 [135263]
   Other proteins in same PDB: d2gj6a1, d2gj6a2, d2gj6b1, d2gj6d1, d2gj6e1
   automatically matched to d1mi5e2
   complexed with 3ib, gol, so4; mutant

Details for d2gj6e2

PDB Entry: 2gj6, 2.56 Å

PDB Description: the complex between tcr a6 and human class i mhc hla-a2 with the modified htlv-1 tax (y5k-4-[3-indolyl]-butyric acid) peptide

PDB Compounds: (E:) A6-Tcr

SCOP Domain Sequences for d2gj6e2:

Sequence; same for both SEQRES and ATOM records:

>d2gj6e2 b.1.1.2 (E:118-246) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgrad

Timeline for d2gj6e2:

• d2gj6e2 first appeared in SCOP 1.73
  
• d2gj6e2 appears in SCOPe 2.01
  
• d2gj6e2 appears in the current release, SCOPe 2.08