SCOP 1.73: Domain d2gj6e1: 2gj6 E:3-117

Lineage for d2gj6e1 (2gj6 E:3-117)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein T-cell antigen receptor [48933] (6 species)
   sequences may differ within each classified species

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (16 PDB entries)

8. Domain d2gj6e1: 2gj6 E:3-117 [135262]
   Other proteins in same PDB: d2gj6a1, d2gj6a2, d2gj6b1, d2gj6d2, d2gj6e2
   automatically matched to d1ao7e1
   complexed with 3ib, gol, so4; mutant

Details for d2gj6e1

PDB Entry: 2gj6, 2.56 Å

PDB Description: the complex between tcr a6 and human class i mhc hla-a2 with the modified htlv-1 tax (y5k-4-[3-indolyl]-butyric acid) peptide

PDB Compounds: (E:) A6-Tcr

SCOP Domain Sequences for d2gj6e1:

Sequence; same for both SEQRES and ATOM records:

>d2gj6e1 b.1.1.1 (E:3-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gvtqtpkfqvlktgqsmtlqcaqdmnheymswyrqdpgmglrlihysvgagitdqgevpn
gynvsrsttedfplrllsaapsqtsvyfcasrpglaggrpeqyfgpgtrltvte

Timeline for d2gj6e1:

• d2gj6e1 is new in SCOP 1.73
  
• d2gj6e1 appears in SCOP 1.75
  
• d2gj6e1 appears in the current release, SCOPe 2.08