SCOP 1.73: Domain d2giya1: 2giy A:218-394

Lineage for d2giya1 (2giy A:218-394)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Alphaherpesvirus glycoprotein E [141008] (1 species)
   elaborated with insertions and C-terminal extensions

7. Species Human herpesvirus 1 [TaxId:10298] [141009] (2 PDB entries)

8. Domain d2giya1: 2giy A:218-394 [135254]

Details for d2giya1

PDB Entry: 2giy, 1.78 Å

PDB Description: crystal structure of the c-terminal domain of the hsv-1 ge ectodomain

PDB Compounds: (A:) Glycoprotein E

SCOP Domain Sequences for d2giya1:

Sequence; same for both SEQRES and ATOM records:

>d2giya1 b.1.1.1 (A:218-394) Alphaherpesvirus glycoprotein E {Human herpesvirus 1 [TaxId: 10298]}
hvrgvtvrmetpeailfspgetfstnvsihaiahddqtysmdvvwlrfdvptscaemriy
esclyhpqlpeclspadapcaastwtsrlavrsyagcsrtnppprcsaeahmepvpglaw
qaasvnlefrdaspqhsglylcvvyvndhihawghitistaaqyrnavveqpldieg

Timeline for d2giya1:

• d2giya1 is new in SCOP 1.73
  
• d2giya1 appears in SCOP 1.75
  
• d2giya1 appears in the current release, SCOPe 2.08