Lineage for d2ghvc1 (2ghv C:320-502)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.318: SARS receptor-binding domain-like [143586] (1 superfamily)
core: 3 layers, a/b/a; antiparallel beta-sheet of 5 strands, order 13542Superfamily d.318.1: SARS receptor-binding domain-like [143587] (1 family) 
automatically mapped to Pfam PF09408Family d.318.1.1: SARS receptor-binding domain-like [143588] (2 proteins)
part of PfamB PB000266Protein Spike protein S1 [143589] (5 species) 
Species SARS coronavirus [TaxId:227859] [143590] (14 PDB entries)
Uniprot P59594 320-502! Uniprot P59594 321-512! Uniprot P59594 323-502
Domain d2ghvc1: 2ghv C:320-502 [135214]
Details for d2ghvc1
PDB Entry: 2ghv (more details), 2.2 Å
PDB Description: Crystal structure of SARS spike protein receptor binding domain
PDB Compounds: (C:) Spike glycoproteinSCOPe Domain Sequences for d2ghvc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ghvc1 d.318.1.1 (C:320-502) Spike protein S1 {SARS coronavirus [TaxId: 227859]}
tnlcpfgevfnatkfpsvyawerkkisncvadysvlynstffstfkcygvsatklndlcf
snvyadsfvvkgddvrqiapgqtgviadynyklpddfmgcvlawntrnidatstgnynyk
yrylrhgklrpferdisnvpfspdgkpctppalncywplndygfytttgigyqpyrvvvl
sfe
SCOPe Domain Coordinates for d2ghvc1:
Click to download the PDB-style file with coordinates for d2ghvc1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2ghvc1:
- d2ghvc1 first appeared in SCOP 1.73
- d2ghvc1 appears in SCOPe 2.07
View in 3D
