Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) |
Family d.58.7.1: Canonical RBD [54929] (67 proteins) |
Protein U4/U6 snRNA-associated-splicing factor PRP24 [143338] (1 species) contains three RBDs |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143339] (1 PDB entry) |
Domain d2ghph2: 2ghp H:41-115 [135206] automatically matched to 2GHP A:41-115 |
PDB Entry: 2ghp (more details), 2.7 Å
SCOP Domain Sequences for d2ghph2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ghph2 d.58.7.1 (H:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} ttvlvknlpksynqnkvykyfkhcgpiihvdvadslkknfrfariefarydgalaaitkt hkvvgqneiivshlt
Timeline for d2ghph2: