Lineage for d2ghpe2 (2ghp E:41-115)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908863Protein U4/U6 snRNA-associated-splicing factor PRP24 [143338] (1 species)
    contains three RBDs
  7. 1908864Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [143339] (2 PDB entries)
    Uniprot P49960 116-196! Uniprot P49960 206-291! Uniprot P49960 41-115
  8. 1908878Domain d2ghpe2: 2ghp E:41-115 [135197]
    automated match to d2ghpa2

Details for d2ghpe2

PDB Entry: 2ghp (more details), 2.7 Å

PDB Description: crystal structure of the n-terminal 3 rna binding domains of the yeast splicing factor prp24
PDB Compounds: (E:) U4/U6 snRNA-associated splicing factor PRP24

SCOPe Domain Sequences for d2ghpe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ghpe2 d.58.7.1 (E:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttvlvknlpksynqnkvykyfkhcgpiihvdvadslkknfrfariefarydgalaaitkt
hkvvgqneiivshlt

SCOPe Domain Coordinates for d2ghpe2:

Click to download the PDB-style file with coordinates for d2ghpe2.
(The format of our PDB-style files is described here.)

Timeline for d2ghpe2: