Lineage for d2ghoa1 (2gho A:6-49,A:173-231)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958148Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2958149Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins)
  6. 2958150Protein RNA polymerase alpha [55259] (3 species)
  7. 2958156Species Thermus aquaticus [TaxId:271] [64314] (4 PDB entries)
  8. 2958163Domain d2ghoa1: 2gho A:6-49,A:173-231 [135180]
    Other proteins in same PDB: d2ghoa2, d2ghob2, d2ghoc1, d2ghod1
    automatically matched to d1i6vb1
    protein/RNA complex

Details for d2ghoa1

PDB Entry: 2gho (more details), 5 Å

PDB Description: recombinant thermus aquaticus rna polymerase for structural studies
PDB Compounds: (A:) DNA-directed RNA polymerase subunit alpha

SCOPe Domain Sequences for d2ghoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ghoa1 d.74.3.1 (A:6-49,A:173-231) RNA polymerase alpha {Thermus aquaticus [TaxId: 271]}
lkapvftattqgdhygefvleplergfgvtlgnplrrillssipXpvrrvafqvedtrlg
qrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeas

SCOPe Domain Coordinates for d2ghoa1:

Click to download the PDB-style file with coordinates for d2ghoa1.
(The format of our PDB-style files is described here.)

Timeline for d2ghoa1: