SCOP 1.73: Domain d2ghkx1: 2ghk X:1-250

Lineage for d2ghkx1 (2ghk X:1-250)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families)

5. Family a.93.1.1: CCP-like [48114] (4 proteins)

6. Protein Ascorbate peroxidase [48123] (3 species)

7. Species Soybean (Glycine max) [TaxId:3847] [89092] (5 PDB entries)

8. Domain d2ghkx1: 2ghk X:1-250 [135179]
   automatically matched to d1oafa_
   complexed with cyn, hem, k

Details for d2ghkx1

PDB Entry: 2ghk, 2 Å

PDB Description: conformational mobility in the active site of a heme peroxidase

PDB Compounds: (X:) cytosolic ascorbate peroxidase 1

SCOP Domain Sequences for d2ghkx1:

Sequence; same for both SEQRES and ATOM records:

>d2ghkx1 a.93.1.1 (X:1-250) Ascorbate peroxidase {Soybean (Glycine max) [TaxId: 3847]}
sgksyptvsadyqkavekakkklrgfiaekrcaplmlrlawhsagtfdkgtktggpfgti
khpaelahsanngldiavrlleplkaefpilsyadfyqlagvvavevtggpevpfhpgre
dkpepppegrlpdatkgsdhlrdvfgkamgltdqdivalsgghtigaahkersgfegpwt
snplifdnsyftellsgekegllqlpsdkallsdpvfrplvdkyaadedaffadyaeahq
klselgfada

Timeline for d2ghkx1:

• d2ghkx1 is new in SCOP 1.73
  
• d2ghkx1 appears in SCOP 1.75
  
• d2ghkx1 appears in the current release, SCOPe 2.08, called d2ghkx2