SCOP 1.73: Domain d2gh2a1: 2gh2 A:5-190

Lineage for d2gh2a1 (2gh2 A:5-190)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (20 families)

5. Family b.82.1.19: Cysteine dioxygenase type I [141615] (1 protein)
   Pfam PF05995, CDO_I

6. Protein Cysteine dioxygenase type I [141616] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [141617] (4 PDB entries)

8. Domain d2gh2a1: 2gh2 A:5-190 [135172]
   automatically matched to 2ATF A:5-190
   complexed with fe, so4

Details for d2gh2a1

PDB Entry: 2gh2, 1.5 Å

PDB Description: 1.5 a resolution r. norvegicus cysteine dioxygenase structure crystallized in the presence of cysteine

PDB Compounds: (A:) Cysteine dioxygenase type I

SCOP Domain Sequences for d2gh2a1:

Sequence; same for both SEQRES and ATOM records:

>d2gh2a1 b.82.1.19 (A:5-190) Cysteine dioxygenase type I {Mouse (Mus musculus) [TaxId: 10090]}
ellkprtladlirilhelfagdevnveevqavleayesnpaewalyakfdqyrytrnlvd
qgngkfnlmilcwgeghgssihdhtdshcflkllqgnlketlfdwpdkksnemikksert
lrenqcayindsiglhrvenvshtepavslhlysppfdtchafdqrtghknkvtmtfhsk
fgirtp

Timeline for d2gh2a1:

• d2gh2a1 is new in SCOP 1.73
  
• d2gh2a1 appears in SCOP 1.75
  
• d2gh2a1 appears in the current release, SCOPe 2.08, called d2gh2a_