SCOP 1.73: Domain d2ggxb1: 2ggx B:236-355

Lineage for d2ggxb1 (2ggx B:236-355)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (8 families)

5. Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
   Pfam PF00059

6. Protein Surfactant protein, lectin domain [56461] (2 species)

7. Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (8 PDB entries)

8. Domain d2ggxb1: 2ggx B:236-355 [135166]
   Other proteins in same PDB: d2ggxa2, d2ggxb2, d2ggxc2
   automatically matched to d1b08a1
   complexed with ca, npj

Details for d2ggxb1

PDB Entry: 2ggx, 1.9 Å

PDB Description: crystal structure of the trimer neck and carbohydrate recognition domain of human surfactant protein d in complex with p-nitrophenyl maltoside

PDB Compounds: (B:) Pulmonary surfactant-associated protein D

SCOP Domain Sequences for d2ggxb1:

Sequence; same for both SEQRES and ATOM records:

>d2ggxb1 d.169.1.1 (B:236-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]}
ngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaaflsm
tdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvcef

Timeline for d2ggxb1:

• d2ggxb1 is new in SCOP 1.73
  
• d2ggxb1 appears in SCOP 1.75
  
• d2ggxb1 appears in the current release, SCOPe 2.08