Lineage for d2ggxa2 (2ggx A:205-235)

  1. Root: SCOP 1.73
  2. 752207Class h: Coiled coil proteins [57942] (7 folds)
  3. 752208Fold h.1: Parallel coiled-coil [57943] (33 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 752209Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) (S)
  5. 752210Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)
  6. 752282Protein Surfactant protein [57949] (2 species)
  7. 752283Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (9 PDB entries)
  8. 752299Domain d2ggxa2: 2ggx A:205-235 [135165]
    Other proteins in same PDB: d2ggxa1, d2ggxb1, d2ggxc1
    automatically matched to d1m7la_
    complexed with ca, npj

Details for d2ggxa2

PDB Entry: 2ggx (more details), 1.9 Å

PDB Description: crystal structure of the trimer neck and carbohydrate recognition domain of human surfactant protein d in complex with p-nitrophenyl maltoside
PDB Compounds: (A:) Pulmonary surfactant-associated protein D

SCOP Domain Sequences for d2ggxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ggxa2 h.1.1.1 (A:205-235) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
aslrqqvealqgqvqhlqaafsqykkvelfp

SCOP Domain Coordinates for d2ggxa2:

Click to download the PDB-style file with coordinates for d2ggxa2.
(The format of our PDB-style files is described here.)

Timeline for d2ggxa2: