Lineage for d2ggxa1 (2ggx A:236-355)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 737894Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 737895Superfamily d.169.1: C-type lectin-like [56436] (8 families) (S)
  5. 737896Family d.169.1.1: C-type lectin domain [56437] (28 proteins)
    Pfam PF00059
  6. 738241Protein Surfactant protein, lectin domain [56461] (2 species)
  7. 738242Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (8 PDB entries)
  8. 738258Domain d2ggxa1: 2ggx A:236-355 [135164]
    Other proteins in same PDB: d2ggxa2, d2ggxb2, d2ggxc2
    automatically matched to d1b08a1
    complexed with ca, npj

Details for d2ggxa1

PDB Entry: 2ggx (more details), 1.9 Å

PDB Description: crystal structure of the trimer neck and carbohydrate recognition domain of human surfactant protein d in complex with p-nitrophenyl maltoside
PDB Compounds: (A:) Pulmonary surfactant-associated protein D

SCOP Domain Sequences for d2ggxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ggxa1 d.169.1.1 (A:236-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]}
ngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaaflsm
tdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvcef

SCOP Domain Coordinates for d2ggxa1:

Click to download the PDB-style file with coordinates for d2ggxa1.
(The format of our PDB-style files is described here.)

Timeline for d2ggxa1: