Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein di-Ras1 [142277] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142278] (1 PDB entry) Uniprot O95057 4-176 |
Domain d2gf0d_: 2gf0 D: [135069] automated match to d2gf0a1 complexed with gdp, mg |
PDB Entry: 2gf0 (more details), 1.9 Å
SCOPe Domain Sequences for d2gf0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gf0d_ c.37.1.8 (D:) di-Ras1 {Human (Homo sapiens) [TaxId: 9606]} ndyrvvvfgaggvgksslvlrfvkgtfrdtyiptiedtyrqviscdksvctlqitdttgs hqfpamqrlsiskghafilvfsvtskqsleelgpiyklivqikgsvedipvmlvgnkcde tqrevdtreaqavaqewkcafmetsakmnynvkelfqelltletrrnmsl
Timeline for d2gf0d_: