SCOPe 2.08: Domain d2gf0c_: 2gf0 C:

Lineage for d2gf0c_ (2gf0 C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (81 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein di-Ras1 [142277] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [142278] (1 PDB entry)
   Uniprot O95057 4-176

8. Domain d2gf0c_: 2gf0 C: [135068]
   automated match to d2gf0a1
   complexed with gdp, mg

Details for d2gf0c_

PDB Entry: 2gf0, 1.9 Å

PDB Description: The crystal structure of the human DiRas1 GTPase in the inactive GDP bound state

PDB Compounds: (C:) GTP-binding protein Di-Ras1

SCOPe Domain Sequences for d2gf0c_:

Sequence; same for both SEQRES and ATOM records:

>d2gf0c_ c.37.1.8 (C:) di-Ras1 {Human (Homo sapiens) [TaxId: 9606]}
ndyrvvvfgaggvgksslvlrfvkgtfrdtyiptiedtyrqviscdksvctlqitdttgs
hqfpamqrlsiskghafilvfsvtskqsleelgpiyklivqikgsvedipvmlvgnkcde
tqrevdtreaqavaqewkcafmetsakmnynvkelfqelltletrrnmsln

Timeline for d2gf0c_:

• d2gf0c_ first appeared in SCOP 1.73, called d2gf0c1
  
• d2gf0c_ appears in SCOPe 2.07