![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) ![]() |
![]() | Family c.1.8.1: Amylase, catalytic domain [51446] (24 proteins) members of the family may contain various insert subdomains in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain |
![]() | Protein Sucrose phosphorylase [102060] (1 species) sequence and close structural relationship to amylosucrase; variations in the C-terminal domain fold |
![]() | Species Bifidobacterium adolescentis [TaxId:1680] [102061] (3 PDB entries) |
![]() | Domain d2gdvb2: 2gdv B:1-434 [135039] Other proteins in same PDB: d2gdva1, d2gdvb1 automatically matched to d1r7aa2 complexed with glc |
PDB Entry: 2gdv (more details), 2 Å
SCOP Domain Sequences for d2gdvb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gdvb2 c.1.8.1 (B:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} mknkvqlityadrlgdgtiksmtdilrtrfdgvydgvhilpfftpfdgadagfdpidhtk vderlgswddvaelskthnimvdaivnhmsweskqfqdvlakgeeseyypmfltmssvfp ngateedlagiyrprpglpfthykfagktrlvwvsftpqqvdidtdsdkgweylmsifdq maashvsyirldavgygakeagtscfmtpktfklisrlreegvkrgleilievhsyykkq veiaskvdrvydfalpplllhalstghvepvahwtdirpnnavtvldthdgigvidigsd qldrslkglvpdedvdnlvntihanthgesqaatgaaasnldlyqvnstyysalgcndqh yiaaravqfflpgvpqvyyvgalagkndmellrktnngrdinrhyystaeidenlkrpvv kalnalakfrneld
Timeline for d2gdvb2: