Lineage for d2gdvb1 (2gdv B:435-504)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419799Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2419800Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2419801Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2420227Protein Sucrose phosphorylase [101920] (1 species)
    single beta-sheet; probable result of a decay of the common-fold
  7. 2420228Species Bifidobacterium adolescentis [TaxId:1680] [101921] (2 PDB entries)
  8. 2420232Domain d2gdvb1: 2gdv B:435-504 [135038]
    Other proteins in same PDB: d2gdva2, d2gdvb2
    automated match to d1r7aa1
    complexed with bgc

Details for d2gdvb1

PDB Entry: 2gdv (more details), 2 Å

PDB Description: sucrose phosphorylase from bifidobacterium adolescentis reacted with sucrose
PDB Compounds: (B:) sucrose phosphorylase

SCOPe Domain Sequences for d2gdvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gdvb1 b.71.1.1 (B:435-504) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]}
afdgtfsyttdddtsisftwrgetsqatltfepkrglgvdnttpvamlewedsagdhrsd
dlianppvva

SCOPe Domain Coordinates for d2gdvb1:

Click to download the PDB-style file with coordinates for d2gdvb1.
(The format of our PDB-style files is described here.)

Timeline for d2gdvb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gdvb2