SCOP 1.75: Domain d2gdub1: 2gdu B:435-504

Lineage for d2gdub1 (2gdu B:435-504)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Sucrose phosphorylase [101920] (1 species)
   single beta-sheet; probable result of a decay of the common-fold

7. Species Bifidobacterium adolescentis [TaxId:1680] [101921] (3 PDB entries)

8. Domain d2gdub1: 2gdu B:435-504 [135034]
   Other proteins in same PDB: d2gdua2, d2gdub2
   automatically matched to d1r7aa1
   complexed with suc; mutant

Details for d2gdub1

PDB Entry: 2gdu, 2.1 Å

PDB Description: e232q mutant of sucrose phosphorylase from bifidobacterium adolescentis in complex with sucrose

PDB Compounds: (B:) sucrose phosphorylase

SCOP Domain Sequences for d2gdub1:

Sequence; same for both SEQRES and ATOM records:

>d2gdub1 b.71.1.1 (B:435-504) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]}
afdgtfsyttdddtsisftwrgetsqatltfepkrglgvdnttpvamlewedsagdhrsd
dlianppvva

Timeline for d2gdub1:

• d2gdub1 first appeared in SCOP 1.73
  
• d2gdub1 appears in SCOPe 2.01
  
• d2gdub1 appears in the current release, SCOPe 2.08