Lineage for d2gdub1 (2gdu B:435-504)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 808141Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 808142Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 808143Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 808516Protein Sucrose phosphorylase [101920] (1 species)
    single beta-sheet; probable result of a decay of the common-fold
  7. 808517Species Bifidobacterium adolescentis [TaxId:1680] [101921] (3 PDB entries)
  8. 808521Domain d2gdub1: 2gdu B:435-504 [135034]
    Other proteins in same PDB: d2gdua2, d2gdub2
    automatically matched to d1r7aa1
    complexed with suc; mutant

Details for d2gdub1

PDB Entry: 2gdu (more details), 2.1 Å

PDB Description: e232q mutant of sucrose phosphorylase from bifidobacterium adolescentis in complex with sucrose
PDB Compounds: (B:) sucrose phosphorylase

SCOP Domain Sequences for d2gdub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gdub1 b.71.1.1 (B:435-504) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]}
afdgtfsyttdddtsisftwrgetsqatltfepkrglgvdnttpvamlewedsagdhrsd
dlianppvva

SCOP Domain Coordinates for d2gdub1:

Click to download the PDB-style file with coordinates for d2gdub1.
(The format of our PDB-style files is described here.)

Timeline for d2gdub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gdub2