SCOPe 2.08: Domain d2gdub1: 2gdu B:435-504

Lineage for d2gdub1 (2gdu B:435-504)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (41 species)
   not a true protein

7. Species Bifidobacterium adolescentis [TaxId:1680] [255184] (4 PDB entries)

8. Domain d2gdub1: 2gdu B:435-504 [135034]
   Other proteins in same PDB: d2gdua2, d2gdub2
   automated match to d1r7aa1
   mutant

Details for d2gdub1

PDB Entry: 2gdu, 2.1 Å

PDB Description: e232q mutant of sucrose phosphorylase from bifidobacterium adolescentis in complex with sucrose

PDB Compounds: (B:) sucrose phosphorylase

SCOPe Domain Sequences for d2gdub1:

Sequence; same for both SEQRES and ATOM records:

>d2gdub1 b.71.1.0 (B:435-504) automated matches {Bifidobacterium adolescentis [TaxId: 1680]}
afdgtfsyttdddtsisftwrgetsqatltfepkrglgvdnttpvamlewedsagdhrsd
dlianppvva

Timeline for d2gdub1:

• d2gdub1 first appeared in SCOP 1.73
  
• d2gdub1 appears in SCOPe 2.07