Lineage for d2gdua1 (2gdu A:435-504)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1327893Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 1327894Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 1327895Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 1328303Protein Sucrose phosphorylase [101920] (1 species)
    single beta-sheet; probable result of a decay of the common-fold
  7. 1328304Species Bifidobacterium adolescentis [TaxId:1680] [101921] (3 PDB entries)
  8. 1328309Domain d2gdua1: 2gdu A:435-504 [135032]
    Other proteins in same PDB: d2gdua2, d2gdub2
    automatically matched to d1r7aa1
    complexed with suc; mutant

Details for d2gdua1

PDB Entry: 2gdu (more details), 2.1 Å

PDB Description: e232q mutant of sucrose phosphorylase from bifidobacterium adolescentis in complex with sucrose
PDB Compounds: (A:) sucrose phosphorylase

SCOPe Domain Sequences for d2gdua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gdua1 b.71.1.1 (A:435-504) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]}
afdgtfsyttdddtsisftwrgetsqatltfepkrglgvdnttpvamlewedsagdhrsd
dlianppvva

SCOPe Domain Coordinates for d2gdua1:

Click to download the PDB-style file with coordinates for d2gdua1.
(The format of our PDB-style files is described here.)

Timeline for d2gdua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gdua2