Lineage for d2gcya1 (2gcy A:2-111)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652980Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 653386Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (28 PDB entries)
  8. 653399Domain d2gcya1: 2gcy A:2-111 [134994]
    Other proteins in same PDB: d2gcya2
    automatically matched to d1egjl1
    complexed with so4

Details for d2gcya1

PDB Entry: 2gcy (more details), 2.5 Å

PDB Description: humanized antibody C25 Fab fragment
PDB Compounds: (A:) huC25 fab fragment light chain

SCOP Domain Sequences for d2gcya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gcya1 b.1.1.1 (A:2-111) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
ivltqspatlslspgeratiscrasesvdsyghsfmqwyqqkpgqaprlliyrasnlepg
iparfsgsgsgtdftltisslepedfavyycqqsneapftfgqgtkveik

SCOP Domain Coordinates for d2gcya1:

Click to download the PDB-style file with coordinates for d2gcya1.
(The format of our PDB-style files is described here.)

Timeline for d2gcya1: