Lineage for d2gc7p1 (2gc7 P:1-147)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760650Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 760651Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 760652Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 760711Protein Cytochrome c551 [46660] (4 species)
  7. 760714Species Paracoccus denitrificans [TaxId:266] [46663] (5 PDB entries)
  8. 760722Domain d2gc7p1: 2gc7 P:1-147 [134969]
    Other proteins in same PDB: d2gc7a1, d2gc7b1, d2gc7c1, d2gc7e1, d2gc7f1, d2gc7g1, d2gc7i1, d2gc7j1, d2gc7k1, d2gc7m1, d2gc7n1, d2gc7o1
    automatically matched to d1mg2d_
    complexed with hem, na, trq

Details for d2gc7p1

PDB Entry: 2gc7 (more details), 1.9 Å

PDB Description: substrate reduced, copper free complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans.
PDB Compounds: (P:) cytochrome c-l

SCOP Domain Sequences for d2gc7p1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gc7p1 a.3.1.1 (P:1-147) Cytochrome c551 {Paracoccus denitrificans [TaxId: 266]}
apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
rhlytgdpkdaswltdeqkagftpfqp

SCOP Domain Coordinates for d2gc7p1:

Click to download the PDB-style file with coordinates for d2gc7p1.
(The format of our PDB-style files is described here.)

Timeline for d2gc7p1: