Lineage for d2gc7j_ (2gc7 J:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2261162Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 2261163Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 2261164Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 2261221Protein automated matches [190303] (3 species)
    not a true protein
  7. 2261222Species Paracoccus denitrificans [TaxId:266] [187112] (6 PDB entries)
  8. 2261225Domain d2gc7j_: 2gc7 J: [134963]
    Other proteins in same PDB: d2gc7a_, d2gc7c_, d2gc7d_, d2gc7e_, d2gc7g_, d2gc7h_, d2gc7i_, d2gc7k_, d2gc7l_, d2gc7m_, d2gc7o_, d2gc7p_
    automated match to d1mg2b_
    complexed with hem, na

Details for d2gc7j_

PDB Entry: 2gc7 (more details), 1.9 Å

PDB Description: substrate reduced, copper free complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans.
PDB Compounds: (J:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d2gc7j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gc7j_ g.21.1.1 (J:) automated matches {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d2gc7j_:

Click to download the PDB-style file with coordinates for d2gc7j_.
(The format of our PDB-style files is described here.)

Timeline for d2gc7j_: