SCOP 1.75: Domain d2gc7c1: 2gc7 C:1-105

Lineage for d2gc7c1 (2gc7 C:1-105)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
   mono-domain proteins

6. Protein Amicyanin [49505] (2 species)

7. Species Paracoccus denitrificans [TaxId:266] [49506] (20 PDB entries)
   Uniprot P22364

8. Domain d2gc7c1: 2gc7 C:1-105 [134956]
   Other proteins in same PDB: d2gc7a1, d2gc7b1, d2gc7d1, d2gc7e1, d2gc7f1, d2gc7h1, d2gc7i1, d2gc7j1, d2gc7l1, d2gc7m1, d2gc7n1, d2gc7p1
   automatically matched to d1aac__
   complexed with hem, na, trq

Details for d2gc7c1

PDB Entry: 2gc7, 1.9 Å

PDB Description: substrate reduced, copper free complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans.

PDB Compounds: (C:) amicyanin

SCOP Domain Sequences for d2gc7c1:

Sequence; same for both SEQRES and ATOM records:

>d2gc7c1 b.6.1.1 (C:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]}
dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag
vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve

Timeline for d2gc7c1:

• d2gc7c1 first appeared in SCOP 1.73
  
• d2gc7c1 is called d2gc7c_ in SCOPe 2.01
  
• d2gc7c1 appears in the current release, SCOPe 2.08, called d2gc7c_