Class b: All beta proteins [48724] (165 folds) |
Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (7 families) contains copper-binding site |
Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins) mono-domain proteins |
Protein Amicyanin [49505] (2 species) |
Species Paracoccus denitrificans [TaxId:266] [49506] (19 PDB entries) |
Domain d2gc4g1: 2gc4 G:1-105 [134940] Other proteins in same PDB: d2gc4a1, d2gc4b1, d2gc4d1, d2gc4e1, d2gc4f1, d2gc4h1, d2gc4i1, d2gc4j1, d2gc4l1, d2gc4m1, d2gc4n1, d2gc4p1 automatically matched to d1aac__ complexed with cu, hem, na, trq |
PDB Entry: 2gc4 (more details), 1.9 Å
SCOP Domain Sequences for d2gc4g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gc4g1 b.6.1.1 (G:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} dkatipsespfaaaevadgaivvdiakmkyetpelhvkvgdtvtwinreamphnvhfvag vlgeaalkgpmmkkeqaysltfteagtydyhctphpfmrgkvvve
Timeline for d2gc4g1: