Lineage for d2gc4d1 (2gc4 D:1-147)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760650Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 760651Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 760652Family a.3.1.1: monodomain cytochrome c [46627] (15 proteins)
  6. 760711Protein Cytochrome c551 [46660] (4 species)
  7. 760714Species Paracoccus denitrificans [TaxId:266] [46663] (5 PDB entries)
  8. 760715Domain d2gc4d1: 2gc4 D:1-147 [134937]
    Other proteins in same PDB: d2gc4a1, d2gc4b1, d2gc4c1, d2gc4e1, d2gc4f1, d2gc4g1, d2gc4i1, d2gc4j1, d2gc4k1, d2gc4m1, d2gc4n1, d2gc4o1
    automatically matched to d1mg2d_
    complexed with cu, hem, na, trq

Details for d2gc4d1

PDB Entry: 2gc4 (more details), 1.9 Å

PDB Description: structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 a resolution.
PDB Compounds: (D:) cytochrome c-l

SCOP Domain Sequences for d2gc4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gc4d1 a.3.1.1 (D:1-147) Cytochrome c551 {Paracoccus denitrificans [TaxId: 266]}
apqffniidgsplnfddameegrdteavkhfletgenvynedpeilpeaeelyagmcsgc
hghyaegkigpglndaywtypgnetdvglfstlyggatgqmgpmwgsltldemlrtmawv
rhlytgdpkdaswltdeqkagftpfqp

SCOP Domain Coordinates for d2gc4d1:

Click to download the PDB-style file with coordinates for d2gc4d1.
(The format of our PDB-style files is described here.)

Timeline for d2gc4d1: