Lineage for d2gc4a1 (2gc4 A:32-386)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1135268Fold b.69: 7-bladed beta-propeller [50964] (14 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 1135287Superfamily b.69.2: YVTN repeat-like/Quinoprotein amine dehydrogenase [50969] (3 families) (S)
  5. 1135288Family b.69.2.1: Methylamine dehydrogenase, H-chain [50970] (1 protein)
    less regular propeller without notable sequence repeats; quinone cofactor is a tryptophan derivative in another subunit
    this is a repeat family; one repeat unit is 1mg2 A:132-178 found in domain
  6. 1135289Protein Methylamine dehydrogenase, H-chain [50971] (2 species)
  7. 1135290Species Paracoccus denitrificans [TaxId:266] [50972] (10 PDB entries)
  8. 1135297Domain d2gc4a1: 2gc4 A:32-386 [134934]
    Other proteins in same PDB: d2gc4b_, d2gc4c_, d2gc4d_, d2gc4f_, d2gc4g_, d2gc4h_, d2gc4j_, d2gc4k_, d2gc4l_, d2gc4n_, d2gc4o_, d2gc4p_
    automatically matched to d2bbkh_
    complexed with cu, hem, na

Details for d2gc4a1

PDB Entry: 2gc4 (more details), 1.9 Å

PDB Description: structural comparison of the oxidized ternary electron transfer complex of methylamine dehydrogenase, amicyanin and cytochrome c551i from paracoccus denitrificans with the substrate-reduced, copper free complex at 1.9 a resolution.
PDB Compounds: (A:) Methylamine dehydrogenase heavy chain

SCOPe Domain Sequences for d2gc4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gc4a1 b.69.2.1 (A:32-386) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]}
deprileapapdarrvyvndpahfaavtqqfvidgeagrvigmidggflpnpvvaddgsf
iahastvfsriargertdyvevfdpvtllptadielpdaprflvgtypwmtsltpdgktl
lfyqfspapavgvvdlegkafkrmldvpdcyhifptapdtffmhcrdgslakvafgtegt
peithtevfhpedeflinhpaysqkagrlvwptytgkihqidlssgdakflpavealtea
eradgwrpggwqqvayhraldriyllvdqrdewrhktasrfvvvldaktgerlakfemgh
eidsinvsqdekpllyalstgdktlyihdaesgeelrsvnqlghgpqvittadmg

SCOPe Domain Coordinates for d2gc4a1:

Click to download the PDB-style file with coordinates for d2gc4a1.
(The format of our PDB-style files is described here.)

Timeline for d2gc4a1: