Lineage for d2gb3f_ (2gb3 F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2895168Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 2895169Protein AAT homologue TM1698 [142661] (1 species)
  7. 2895170Species Thermotoga maritima [TaxId:2336] [142662] (1 PDB entry)
    Uniprot Q9X224 4-392
  8. 2895176Domain d2gb3f_: 2gb3 F: [134908]
    Other proteins in same PDB: d2gb3b3, d2gb3e3
    automated match to d2gb3a1

Details for d2gb3f_

PDB Entry: 2gb3 (more details), 2.5 Å

PDB Description: Crystal structure of Aspartate aminotransferase (tm1698) from Thermotoga maritima at 2.50 A resolution
PDB Compounds: (F:) aspartate aminotransferase

SCOPe Domain Sequences for d2gb3f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gb3f_ c.67.1.1 (F:) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]}
vfsdrvllteespirklvpfaemakkrgvrihhlnigqpdlktpevfferiyenkpevvy
yshsagiwelreafasyykrrqrvdvkpenvlvtnggseailfsfavianpgdeilvlep
fyanynafakiagvklipvtrrmeegfaipqnlesfinertkgivlsnpcnptgvvygkd
emrylveiaerhglflivdevyseivfrgefasalsiesdkvvvidsvskkfsacgarvg
clitrneelishamklaqgrlapplleqigsvgllnlddsffdfvretyrervetvlkkl
eehglkrftkpsgafyitaelpvedaeefarwmltdfnmdgettmvaplrgfyltpglgk
keiriacvlekdllsraidvlmeglkmfc

SCOPe Domain Coordinates for d2gb3f_:

Click to download the PDB-style file with coordinates for d2gb3f_.
(The format of our PDB-style files is described here.)

Timeline for d2gb3f_: