SCOPe 2.03: Domain d2g9xd2: 2g9x D:309-432

Lineage for d2g9xd2 (2g9x D:309-432)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [47958] (9 PDB entries)

8. Domain d2g9xd2: 2g9x D:309-432 [134849]
   Other proteins in same PDB: d2g9xa_, d2g9xc_
   automatically matched to d1vin_2
   complexed with nu5

Details for d2g9xd2

PDB Entry: 2g9x, 2.5 Å

PDB Description: Structure of Thr 160 phosphorylated CDK2/cyclin A in complex with the inhibitor NU6271

PDB Compounds: (D:) Cyclin-A2

SCOPe Domain Sequences for d2g9xd2:

Sequence; same for both SEQRES and ATOM records:

>d2g9xd2 a.74.1.1 (D:309-432) Cyclin A {Cow (Bos taurus) [TaxId: 9913]}
ptinqfltqyflhqqpanckveslamflgelslidadpylkylpsviaaaafhlalytvt
gqswpeslvqktgytletlkpclldlhqtylrapqhaqqsirekyknskyhgvsllnppe
tlnl

Timeline for d2g9xd2:

• d2g9xd2 first appeared in SCOP 1.73
  
• d2g9xd2 appears in SCOPe 2.02
  
• d2g9xd2 appears in SCOPe 2.04
  
• d2g9xd2 appears in the current release, SCOPe 2.08