Lineage for d2g98b1 (2g98 B:1-85)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773466Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)
  6. 2773579Protein automated matches [254533] (1 species)
    not a true protein
  7. 2773580Species Human (Homo sapiens) [TaxId:9606] [255181] (6 PDB entries)
  8. 2773583Domain d2g98b1: 2g98 B:1-85 [134796]
    automated match to d1h4ax1

Details for d2g98b1

PDB Entry: 2g98 (more details), 2.2 Å

PDB Description: human gamma-d-crystallin
PDB Compounds: (B:) gamma crystallin d

SCOPe Domain Sequences for d2g98b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g98b1 b.11.1.1 (B:1-85) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gkitlyedrgfqgrhyecssdhpnlqpylsrcnsasvdsgcwmlyeqpnysglqyflrrg
dyadhqqwmglsdsvrscrliphsg

SCOPe Domain Coordinates for d2g98b1:

Click to download the PDB-style file with coordinates for d2g98b1.
(The format of our PDB-style files is described here.)

Timeline for d2g98b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g98b2