SCOPe 2.05: Domain d2g82c1: 2g82 C:1-148,C:311-330

Lineage for d2g82c1 (2g82 C:1-148,C:311-330)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [51801] (19 species)

7. Species Thermus aquaticus [TaxId:271] [51804] (2 PDB entries)

8. Domain d2g82c1: 2g82 C:1-148,C:311-330 [134750]
   Other proteins in same PDB: d2g82a2, d2g82b2, d2g82c2, d2g82d2, d2g82o2, d2g82p2, d2g82q2, d2g82r2
   automated match to d1cero1
   complexed with gol, ipa, na, nad, pge

Details for d2g82c1

PDB Entry: 2g82, 1.65 Å

PDB Description: High Resolution Structures of Thermus aquaticus Glyceraldehyde-3-Phosphate Dehydrogenase: Role of 220's Loop Motion in Catalysis

PDB Compounds: (C:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d2g82c1:

Sequence; same for both SEQRES and ATOM records:

>d2g82c1 c.2.1.3 (C:1-148,C:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]}
mkvgingfgrigrqvfrilhsrgvevalindltdnktlahllkydsiyhrfpgevayddq
ylyvdgkairatavkdpkeipwaeagvgvviestgvftdadkakahleggakkviitapa
kgeditivmgvnheaydpsrhhiisnasXnewgyanrvadlvelvlrkg

Timeline for d2g82c1:

• d2g82c1 first appeared in SCOP 1.73
  
• d2g82c1 appears in SCOPe 2.04
  
• d2g82c1 appears in SCOPe 2.06
  
• d2g82c1 appears in the current release, SCOPe 2.08