Lineage for d2g77a2 (2g77 A:443-630)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1273476Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
    core: 4-5 helices; bundle; left-handed superhelix
  4. 1273607Superfamily a.69.2: Ypt/Rab-GAP domain of gyp1p [47923] (1 family) (S)
  5. 1273608Family a.69.2.1: Ypt/Rab-GAP domain of gyp1p [47924] (1 protein)
    duplication: contains two similar domains of this fold
  6. 1273609Protein Ypt/Rab-GAP domain of gyp1p [47925] (1 species)
  7. 1273610Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [47926] (2 PDB entries)
  8. 1273614Domain d2g77a2: 2g77 A:443-630 [134731]
    Other proteins in same PDB: d2g77b1
    automatically matched to d1fkma2
    complexed with af3, gdp, mg

Details for d2g77a2

PDB Entry: 2g77 (more details), 2.26 Å

PDB Description: crystal structure of gyp1 tbc domain in complex with rab33 gtpase bound to gdp and alf3
PDB Compounds: (A:) GTPase-activating protein GYP1

SCOPe Domain Sequences for d2g77a2:

Sequence, based on SEQRES records: (download)

>d2g77a2 a.69.2.1 (A:443-630) Ypt/Rab-GAP domain of gyp1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gqpgilrqvknlsqlvkridadlynhfqnehvefiqfafrwmncllmrefqmgtvirmwd
tylsetsqevtssysmssndikppvtpteprvasfvtptkdfqspttalsnmtpnnaved
sgkmrqsslnefhvfvcaaflikwsdqlmemdfqetitflqnpptkdwtetdiemllsea
fiwqslyk

Sequence, based on observed residues (ATOM records): (download)

>d2g77a2 a.69.2.1 (A:443-630) Ypt/Rab-GAP domain of gyp1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gqpgilrqvknlsqlvkridadlynhfqnehvefiqfafrwmncllmrefqmgtvirmwd
tylsetsqqsslnefhvfvcaaflikwsdqlmemdfqetitflqnpptkdwtetdiemll
seafiwqslyk

SCOPe Domain Coordinates for d2g77a2:

Click to download the PDB-style file with coordinates for d2g77a2.
(The format of our PDB-style files is described here.)

Timeline for d2g77a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g77a1
View in 3D
Domains from other chains:
(mouse over for more information)
d2g77b1