Lineage for d2g60h1 (2g60 H:103-224)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655438Domain d2g60h1: 2g60 H:103-224 [134684]
    automatically matched to d1ck0h2

Details for d2g60h1

PDB Entry: 2g60 (more details), 1.85 Å

PDB Description: structure of anti-flag m2 fab domain
PDB Compounds: (H:) anti-FLAG M2 Fab heavy chain

SCOP Domain Sequences for d2g60h1:

Sequence, based on SEQRES records: (download)

>d2g60h1 b.1.1.2 (H:103-224) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
wgqgttltvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtltwnsgslssg
vhtfpavlqsdlytlsssvtvtssprpsetvtcnvahpasstkvdkkiv

Sequence, based on observed residues (ATOM records): (download)

>d2g60h1 b.1.1.2 (H:103-224) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
wgqgttltvssakttppsvyplapsmvtlgclvkgyfpepvtltwnsgslssgvhtfpav
lqsdlytlsssvtvtssprpsetvtcnvahpasstkvdkkiv

SCOP Domain Coordinates for d2g60h1:

Click to download the PDB-style file with coordinates for d2g60h1.
(The format of our PDB-style files is described here.)

Timeline for d2g60h1: