SCOPe 2.02: Domain d2g5ic1: 2g5i C:3-100

Lineage for d2g5ic1 (2g5i C:3-100)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.12: Glu-tRNAGln amidotransferase C subunit [141000] (1 family)

5. Family a.137.12.1: Glu-tRNAGln amidotransferase C subunit [141001] (1 protein)
   Pfam PF02686

6. Protein Glu-tRNAGln amidotransferase C subunit, GatC [141002] (2 species)

7. Species Staphylococcus aureus [TaxId:1280] [141003] (5 PDB entries)
   Uniprot P68807 2-100

8. Domain d2g5ic1: 2g5i C:3-100 [134665]
   Other proteins in same PDB: d2g5ia1, d2g5ib1, d2g5ib2
   automatically matched to 2DF4 C:2-100
   protein/RNA complex; complexed with adp, mg

Details for d2g5ic1

PDB Entry: 2g5i, 3.35 Å

PDB Description: Structure of tRNA-Dependent Amidotransferase GatCAB complexed with ADP-AlF4

PDB Compounds: (C:) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

SCOPe Domain Sequences for d2g5ic1:

Sequence; same for both SEQRES and ATOM records:

>d2g5ic1 a.137.12.1 (C:3-100) Glu-tRNAGln amidotransferase C subunit, GatC {Staphylococcus aureus [TaxId: 1280]}
kvtreevehianlarlqispeeteemantlesildfakqndsadtegveptyhvldlqnv
lredkaikgipqelalknaketedgqfkvptimneeda

Timeline for d2g5ic1:

• d2g5ic1 first appeared in SCOP 1.73
  
• d2g5ic1 appears in SCOPe 2.01
  
• d2g5ic1 appears in SCOPe 2.03
  
• d2g5ic1 appears in the current release, SCOPe 2.08