Class a: All alpha proteins [46456] (284 folds) |
Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies) not a true fold |
Superfamily a.137.12: Glu-tRNAGln amidotransferase C subunit [141000] (1 family) |
Family a.137.12.1: Glu-tRNAGln amidotransferase C subunit [141001] (1 protein) Pfam PF02686 |
Protein Glu-tRNAGln amidotransferase C subunit, GatC [141002] (2 species) |
Species Staphylococcus aureus [TaxId:1280] [141003] (5 PDB entries) Uniprot P68807 2-100 |
Domain d2g5ic1: 2g5i C:3-100 [134665] Other proteins in same PDB: d2g5ia1, d2g5ib1, d2g5ib2 automatically matched to 2DF4 C:2-100 protein/RNA complex; complexed with adp, mg |
PDB Entry: 2g5i (more details), 3.35 Å
SCOPe Domain Sequences for d2g5ic1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g5ic1 a.137.12.1 (C:3-100) Glu-tRNAGln amidotransferase C subunit, GatC {Staphylococcus aureus [TaxId: 1280]} kvtreevehianlarlqispeeteemantlesildfakqndsadtegveptyhvldlqnv lredkaikgipqelalknaketedgqfkvptimneeda
Timeline for d2g5ic1: