Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily) duplication: common core consists of two beta-alpha-beta2-alpha repeats |
Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) |
Family d.128.1.5: GatB/GatE catalytic domain-like [143812] (2 proteins) N-terminal and C-terminal parts correspond to Pfam PF02934 (GatB_N) and Pfam PF01162 (GatB), respectively |
Protein Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, GatB, N-terminal domain [143813] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [143814] (5 PDB entries) Uniprot P64201 2-293 |
Domain d2g5hb2: 2g5h B:3-293 [134660] Other proteins in same PDB: d2g5ha_, d2g5hb1, d2g5hc_ automated match to d2df4b2 protein/RNA complex; complexed with mg |
PDB Entry: 2g5h (more details), 2.5 Å
SCOPe Domain Sequences for d2g5hb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g5hb2 d.128.1.5 (B:3-293) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, GatB, N-terminal domain {Staphylococcus aureus [TaxId: 1280]} fetviglevhvelktdskmfspspahfgaepnsntnvidlaypgvlpvvnkravdwamra amalnmeiateskfdrknyfypdnpkayqisqfdqpigengyidievdgetkrigitrlh meedagksthkgeyslvdlnrqgtplieivsepdirspkeayayleklrsiiqytgvsdv kmeegslrcdanislrpygqekfgtkaelknlnsfnyvrkgleyeekrqeeellnggeig qetrrfdestgktilmrvkegsddyryfpepdivplyiddawkervrqtip
Timeline for d2g5hb2: