Lineage for d2g5hb2 (2g5h B:3-293)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 872298Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 872299Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (5 families) (S)
  5. 872500Family d.128.1.5: GatB/GatE catalytic domain-like [143812] (2 proteins)
    N-terminal and C-terminal parts correspond to Pfam PF02934 (GatB_N) and Pfam PF01162 (GatB), respectively
  6. 872501Protein Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, GatB, N-terminal domain [143813] (1 species)
  7. 872502Species Staphylococcus aureus [TaxId:1280] [143814] (5 PDB entries)
    Uniprot P64201 2-293
  8. 872504Domain d2g5hb2: 2g5h B:3-293 [134660]
    Other proteins in same PDB: d2g5ha1, d2g5hb1, d2g5hc1
    automatically matched to 2DF4 B:2-293
    complexed with mg

Details for d2g5hb2

PDB Entry: 2g5h (more details), 2.5 Å

PDB Description: Structure of tRNA-Dependent Amidotransferase GatCAB
PDB Compounds: (B:) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B

SCOP Domain Sequences for d2g5hb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g5hb2 d.128.1.5 (B:3-293) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, GatB, N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
fetviglevhvelktdskmfspspahfgaepnsntnvidlaypgvlpvvnkravdwamra
amalnmeiateskfdrknyfypdnpkayqisqfdqpigengyidievdgetkrigitrlh
meedagksthkgeyslvdlnrqgtplieivsepdirspkeayayleklrsiiqytgvsdv
kmeegslrcdanislrpygqekfgtkaelknlnsfnyvrkgleyeekrqeeellnggeig
qetrrfdestgktilmrvkegsddyryfpepdivplyiddawkervrqtip

SCOP Domain Coordinates for d2g5hb2:

Click to download the PDB-style file with coordinates for d2g5hb2.
(The format of our PDB-style files is described here.)

Timeline for d2g5hb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g5hb1