Lineage for d2g5hb1 (2g5h B:294-400)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 779833Fold a.182: GatB/YqeY motif [89094] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles (4-helical and 3-helical)
  4. 779834Superfamily a.182.1: GatB/YqeY motif [89095] (2 families) (S)
  5. 779839Family a.182.1.2: GatB/GatE C-terminal domain-like [140757] (2 proteins)
    assigned to the same Pfam PF02637 family as YeqY by the presence of a common sequence motif with an alpha-hairpin structure
  6. 779840Protein Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, GatB, C-terminal domain [140758] (1 species)
  7. 779841Species Staphylococcus aureus [TaxId:1280] [140759] (5 PDB entries)
    Uniprot P64201 294-400
  8. 779843Domain d2g5hb1: 2g5h B:294-400 [134659]
    Other proteins in same PDB: d2g5ha1, d2g5hb2, d2g5hc1
    automatically matched to 2DF4 B:294-400
    complexed with mg

Details for d2g5hb1

PDB Entry: 2g5h (more details), 2.5 Å

PDB Description: Structure of tRNA-Dependent Amidotransferase GatCAB
PDB Compounds: (B:) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B

SCOP Domain Sequences for d2g5hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g5hb1 a.182.1.2 (B:294-400) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B, GatB, C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
elpderkakyvnelglpaydahvltltkemsdffestiehgadvkltsnwlmggvneyln
knqvelldtkltpenlagmikliedgtmsskiakkvfpelaakggna

SCOP Domain Coordinates for d2g5hb1:

Click to download the PDB-style file with coordinates for d2g5hb1.
(The format of our PDB-style files is described here.)

Timeline for d2g5hb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g5hb2