Lineage for d2g5ha1 (2g5h A:1-485)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712842Fold c.117: Amidase signature (AS) enzymes [75303] (1 superfamily)
    possible duplication: the topologies of N- and C-terminal halves are similar; 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213549A867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 712843Superfamily c.117.1: Amidase signature (AS) enzymes [75304] (1 family) (S)
  5. 712844Family c.117.1.1: Amidase signature (AS) enzymes [75305] (4 proteins)
  6. 712863Protein Glutamyl-tRNA(Gln) amidotransferase subunit A [142738] (2 species)
  7. 712864Species Staphylococcus aureus [TaxId:1280] [142739] (5 PDB entries)
  8. 712866Domain d2g5ha1: 2g5h A:1-485 [134658]
    Other proteins in same PDB: d2g5hb1, d2g5hb2, d2g5hc1
    automatically matched to 2DF4 A:1-485
    complexed with mg

Details for d2g5ha1

PDB Entry: 2g5h (more details), 2.5 Å

PDB Description: Structure of tRNA-Dependent Amidotransferase GatCAB
PDB Compounds: (A:) Glutamyl-tRNA(Gln) amidotransferase subunit A

SCOP Domain Sequences for d2g5ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g5ha1 c.117.1.1 (A:1-485) Glutamyl-tRNA(Gln) amidotransferase subunit A {Staphylococcus aureus [TaxId: 1280]}
msiryesvenlltlikdkkikpsdvvkdiydaieetdptiksflaldkenaikkaqelde
lqakdqmdgklfgipmgikdniitnglettcaskmlegfvpiyestvmeklhkenavlig
klnmdefamggstetsyfkktvnpfdhkavpggssggsaaavaaglvplslgsdtggsir
qpaaycgvvgmkptygrvsrfglvafassldqigpltrnvkdnaivleaisgadvndsts
apvddvdftseigkdikglkvalpkeylgegvaddvkeavqnavetlkslgavveevslp
ntkfgipsyyviasseassnlsrfdgirygyhskeahsleelykmsrsegfgkevkrrif
lgtfalssgyydayykksqkvrtlikndfdkvfenydvvvgptapttafnlgeeiddplt
myandllttpvnlaglpgisvpcgqsngrpiglqfigkpfdektlyrvayqyetqynlhd
vyekl

SCOP Domain Coordinates for d2g5ha1:

Click to download the PDB-style file with coordinates for d2g5ha1.
(The format of our PDB-style files is described here.)

Timeline for d2g5ha1: