Lineage for d2g50h3 (2g50 H:396-530)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1855807Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 1855808Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) (S)
  5. 1855809Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein)
    automatically mapped to Pfam PF02887
  6. 1855810Protein Pyruvate kinase, C-terminal domain [52937] (6 species)
  7. 1855848Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [52939] (7 PDB entries)
  8. 1855856Domain d2g50h3: 2g50 H:396-530 [134641]
    Other proteins in same PDB: d2g50a1, d2g50a2, d2g50b1, d2g50b2, d2g50c1, d2g50c2, d2g50d1, d2g50d2, d2g50e1, d2g50e2, d2g50f1, d2g50f2, d2g50g1, d2g50g2, d2g50h1, d2g50h2
    automatically matched to d1a49a3
    complexed with ala, edo, ete, gol, k, mn, na, pyr

Details for d2g50h3

PDB Entry: 2g50 (more details), 1.65 Å

PDB Description: the location of the allosteric amino acid binding site of muscle pyruvate kinase.
PDB Compounds: (H:) Pyruvate kinase isozymes M1/M2

SCOPe Domain Sequences for d2g50h3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g50h3 c.49.1.1 (H:396-530) Pyruvate kinase, C-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
elarassqstdlmeamamgsveasykclaaalivltesgrsahqvaryrprapiiavtrn
hqtarqahlyrgifpvvckdpvqeawaedvdlrvnlamnvgkargffkkgdvvivltgwr
pgsgftntmrvvpvp

SCOPe Domain Coordinates for d2g50h3:

Click to download the PDB-style file with coordinates for d2g50h3.
(The format of our PDB-style files is described here.)

Timeline for d2g50h3: