SCOP 1.73: Domain d2g4xa1: 2g4x A:21-124

Lineage for d2g4xa1 (2g4x A:21-124)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (1 family)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (142 PDB entries)

8. Domain d2g4xa1: 2g4x A:21-124 [134615]
   automatically matched to d1rbc__
   complexed with cl, so4

Details for d2g4xa1

PDB Entry: 2g4x, 1.95 Å

PDB Description: Anomalous substructure od ribonuclease A (P3221)

PDB Compounds: (A:) ribonuclease pancreatic

SCOP Domain Sequences for d2g4xa1:

Sequence; same for both SEQRES and ATOM records:

>d2g4xa1 d.5.1.1 (A:21-124) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
sssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystms
itdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

Timeline for d2g4xa1:

• d2g4xa1 is new in SCOP 1.73
  
• d2g4xa1 appears in SCOP 1.75
  
• d2g4xa1 appears in the current release, SCOPe 2.08, called d2g4xa_