Lineage for d2g3qb1 (2g3q B:1-76)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 717080Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 717081Superfamily d.15.1: Ubiquitin-like [54236] (7 families) (S)
  5. 717082Family d.15.1.1: Ubiquitin-related [54237] (38 proteins)
    Pfam PF00240
  6. 717214Protein Ubiquitin [54238] (3 species)
  7. 717215Species Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId:4932] [89830] (4 PDB entries)
  8. 717219Domain d2g3qb1: 2g3q B:1-76 [134569]
    automatically matched to d1otrb_

Details for d2g3qb1

PDB Entry: 2g3q (more details)

PDB Description: Solution Structure of Ede1 UBA-ubiquitin complex
PDB Compounds: (B:) Ubiquitin

SCOP Domain Sequences for d2g3qb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g3qb1 d.15.1.1 (B:1-76) Ubiquitin {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]}
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrgg

SCOP Domain Coordinates for d2g3qb1:

Click to download the PDB-style file with coordinates for d2g3qb1.
(The format of our PDB-style files is described here.)

Timeline for d2g3qb1: