Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families) division into families based on beta-sheet topologies |
Family c.37.1.19: Tandem AAA-ATPase domain [81268] (23 proteins) duplication: tandem repeat of two RecA-like (AAA) domains |
Protein ATP-dependent RNA helicase DDX25 [142310] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [142311] (1 PDB entry) Uniprot Q9UHL0 307-474 |
Domain d2g2ja1: 2g2j A:307-474 [134536] C-terminal domain complexed with so4 |
PDB Entry: 2g2j (more details), 2.8 Å
SCOP Domain Sequences for d2g2ja1:
Sequence, based on SEQRES records: (download)
>d2g2ja1 c.37.1.19 (A:307-474) ATP-dependent RNA helicase DDX25 {Human (Homo sapiens) [TaxId: 9606]} ltlnnirqyyvlcehrkdkyqalcniygsitigqaiifcqtrrnakwltvemiqdghqvs llsgeltveqrasiiqrfrdgkekvlittnvcargidvkqvtivvnfdlpvkqgeepdye tylhrigrtgrfgkkglafnmievdelpslmkiqdhfnssikqlnaed
>d2g2ja1 c.37.1.19 (A:307-474) ATP-dependent RNA helicase DDX25 {Human (Homo sapiens) [TaxId: 9606]} ltlnnirqyyvlcehrkdkyqalcniygsitigqaiifcqtrrnakwltvemiqdghqvs llsgeltveqrasiiqrfrdgkekvlittnvcargidvkqvtivvnfdlpvpdyetylhr igrtkglafnmievdelpslmkiqdhfnssikqlnaed
Timeline for d2g2ja1: