Lineage for d2g28a3 (2g28 A:701-886)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 700279Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 700280Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) (S)
  5. 700281Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins)
  6. 700282Protein Pyruvate dehydrogenase E1 component, C-domain [75239] (1 species)
    E1A and E1B fused together in a single-chain protein
  7. 700283Species Escherichia coli [TaxId:562] [75240] (6 PDB entries)
  8. 700288Domain d2g28a3: 2g28 A:701-886 [134531]
    Other proteins in same PDB: d2g28a1, d2g28a2, d2g28b1, d2g28b2
    automatically matched to d1l8aa3
    complexed with mg, tdk

Details for d2g28a3

PDB Entry: 2g28 (more details), 1.85 Å

PDB Description: E. Coli Pyruvate Dehydrogenase H407A variant Phosphonolactylthiamin Diphosphate Complex
PDB Compounds: (A:) Pyruvate dehydrogenase E1 component

SCOP Domain Sequences for d2g28a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g28a3 c.48.1.1 (A:701-886) Pyruvate dehydrogenase E1 component, C-domain {Escherichia coli [TaxId: 562]}
mpegaeegirkgiykletiegskgkvqllgsgsilrhvreaaeilakdygvgsdvysvts
ftelardgqdcerwnmlhpletprvpyiaqvmndapavastdymklfaeqvrtyvpaddy
rvlgtdgfgrsdsrenlrhhfevdasyvvvaalgelakrgeidkkvvadaiakfnidadk
vnprla

SCOP Domain Coordinates for d2g28a3:

Click to download the PDB-style file with coordinates for d2g28a3.
(The format of our PDB-style files is described here.)

Timeline for d2g28a3: