Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (3 families) |
Family c.48.1.1: Transketolase C-terminal domain-like [52923] (2 proteins) |
Protein Pyruvate dehydrogenase E1 component, C-domain [75239] (1 species) E1A and E1B fused together in a single-chain protein |
Species Escherichia coli [TaxId:562] [75240] (6 PDB entries) |
Domain d2g25b3: 2g25 B:701-886 [134528] Other proteins in same PDB: d2g25a1, d2g25a2, d2g25b1, d2g25b2 automatically matched to d1l8aa3 complexed with mg, po4, tdk |
PDB Entry: 2g25 (more details), 2.1 Å
SCOP Domain Sequences for d2g25b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g25b3 c.48.1.1 (B:701-886) Pyruvate dehydrogenase E1 component, C-domain {Escherichia coli [TaxId: 562]} mpegaeegirkgiykletiegskgkvqllgsgsilrhvreaaeilakdygvgsdvysvts ftelardgqdcerwnmlhpletprvpyiaqvmndapavastdymklfaeqvrtyvpaddy rvlgtdgfgrsdsrenlrhhfevdasyvvvaalgelakrgeidkkvvadaiakfnidadk vnprla
Timeline for d2g25b3: