Lineage for d2g25a1 (2g25 A:471-700)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 694610Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 694611Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 694732Family c.36.1.6: TK-like Pyr module [88735] (2 proteins)
    different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain
  6. 694733Protein Pyruvate dehydrogenase E1 component, Pyr module [88739] (1 species)
    E1A and E1B fused together in a single-chain protein
  7. 694734Species Escherichia coli [TaxId:562] [88740] (6 PDB entries)
  8. 694741Domain d2g25a1: 2g25 A:471-700 [134523]
    Other proteins in same PDB: d2g25a2, d2g25a3, d2g25b2, d2g25b3
    automatically matched to d1l8aa2
    complexed with mg, po4, tdk

Details for d2g25a1

PDB Entry: 2g25 (more details), 2.1 Å

PDB Description: e. coli pyruvate dehydrogenase phosphonolactylthiamin diphosphate complex
PDB Compounds: (A:) Pyruvate dehydrogenase E1 component

SCOP Domain Sequences for d2g25a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g25a1 c.36.1.6 (A:471-700) Pyruvate dehydrogenase E1 component, Pyr module {Escherichia coli [TaxId: 562]}
eklelpslqdfgalleeqskeisttiafvralnvmlknksikdrlvpiiadeartfgmeg
lfrqigiyspngqqytpqdreqvayykedekgqilqeginelgagcswlaaatsystnnl
pmipfyiyysmfgfqrigdlcwaagdqqargfliggtsgrttlngeglqhedghshiqsl
tipncisydpayayevavimhdglermygekqenvyyyittlnenyhmpa

SCOP Domain Coordinates for d2g25a1:

Click to download the PDB-style file with coordinates for d2g25a1.
(The format of our PDB-style files is described here.)

Timeline for d2g25a1: