Lineage for d2g17a1 (2g17 A:1-153,A:309-334)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2104791Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2105341Protein N-acetyl-gamma-glutamyl-phosphate reductase ArgC [110423] (3 species)
  7. 2105342Species Salmonella typhimurium [TaxId:90371] [141918] (1 PDB entry)
    Uniprot Q8ZKL8 1-153,309-334
  8. 2105343Domain d2g17a1: 2g17 A:1-153,A:309-334 [134512]
    Other proteins in same PDB: d2g17a2, d2g17a3
    complexed with so4

Details for d2g17a1

PDB Entry: 2g17 (more details), 2.3 Å

PDB Description: The structure of N-acetyl-gamma-glutamyl-phosphate reductase from Salmonella typhimurium.
PDB Compounds: (A:) N-acetyl-gamma-glutamyl-phosphate reductase

SCOPe Domain Sequences for d2g17a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]}
mlntlivgasgyagaelvsyvnrhphmtitaltvsaqsndagklisdlhpqlkgivdlpl
qpmsdvrdfsadvdvvflatahevshdlapqflqagcvvfdlsgafrvndrafyekyygf
thqypelleqavyglaewnvdklntanliavpgXllkgaaaqavqcanirfgfaetqsli

SCOPe Domain Coordinates for d2g17a1:

Click to download the PDB-style file with coordinates for d2g17a1.
(The format of our PDB-style files is described here.)

Timeline for d2g17a1: