SCOP 1.73: Domain d2g0xa1: 2g0x A:0-153

Lineage for d2g0xa1 (2g0x A:0-153)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Myoglobin [46469] (9 species)

7. Species Sperm whale (Physeter catodon) [TaxId:9755] [46470] (173 PDB entries)

8. Domain d2g0xa1: 2g0x A:0-153 [134505]
   automatically matched to d1jdo__
   complexed with cmo, hem, so4; mutant

Details for d2g0xa1

PDB Entry: 2g0x, 1.95 Å

PDB Description: photolyzed co l29f myoglobin: 316ps

PDB Compounds: (A:) Myoglobin

SCOP Domain Sequences for d2g0xa1:

Sequence; same for both SEQRES and ATOM records:

>d2g0xa1 a.1.1.2 (A:0-153) Myoglobin {Sperm whale (Physeter catodon) [TaxId: 9755]}
mvlsegewqlvlhvwakveadvaghgqdifirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

Timeline for d2g0xa1:

• d2g0xa1 is new in SCOP 1.73
  
• d2g0xa1 appears in SCOP 1.75
  
• d2g0xa1 appears in the current release, SCOPe 2.08, called d2g0xa_