Lineage for d2fzfb_ (2fzf B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 910725Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 910726Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 910727Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 911381Protein Hypothetical protein PF1190 [140438] (1 species)
    significant sequence similarity to the half-ferritin family
  7. 911382Species Pyrococcus furiosus [TaxId:2261] [140439] (1 PDB entry)
    Uniprot Q8U1L6 9-166
  8. 911384Domain d2fzfb_: 2fzf B: [134438]
    automated match to d2fzfa1

Details for d2fzfb_

PDB Entry: 2fzf (more details), 2.7 Å

PDB Description: Hypothetical Protein Pfu-1136390-001 From Pyrococcus furiosus
PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2fzfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fzfb_ a.25.1.1 (B:) Hypothetical protein PF1190 {Pyrococcus furiosus [TaxId: 2261]}
glpiekmadfsleellgmaikaeigarefykslaekikiealkekinwlaeeekkheall
rklysqmfpgkevvfpkehigpelqpvarelekvqdiidlirwamkaeeiaaefylklee
mvkeeekkrlmryladmerghyytlraeyelllnwemy

SCOPe Domain Coordinates for d2fzfb_:

Click to download the PDB-style file with coordinates for d2fzfb_.
(The format of our PDB-style files is described here.)

Timeline for d2fzfb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fzfa1