Lineage for d2fzfa1 (2fzf A:10-167)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 638520Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 639021Protein Hypothetical protein PF1190 [140438] (1 species)
    significant sequence similarity to the half-ferritin family
  7. 639022Species Archaeon Pyrococcus furiosus [TaxId:2261] [140439] (1 PDB entry)
  8. 639023Domain d2fzfa1: 2fzf A:10-167 [134437]

Details for d2fzfa1

PDB Entry: 2fzf (more details), 2.7 Å

PDB Description: Hypothetical Protein Pfu-1136390-001 From Pyrococcus furiosus
PDB Compounds: (A:) hypothetical protein

SCOP Domain Sequences for d2fzfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fzfa1 a.25.1.1 (A:10-167) Hypothetical protein PF1190 {Archaeon Pyrococcus furiosus [TaxId: 2261]}
glpiekmadfsleellgmaikaeigarefykslaekikiealkekinwlaeeekkheall
rklysqmfpgkevvfpkehigpelqpvarelekvqdiidlirwamkaeeiaaefylklee
mvkeeekkrlmryladmerghyytlraeyelllnwemy

SCOP Domain Coordinates for d2fzfa1:

Click to download the PDB-style file with coordinates for d2fzfa1.
(The format of our PDB-style files is described here.)

Timeline for d2fzfa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fzfb1