Lineage for d2fz3a1 (2fz3 A:182-276)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 784408Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 784409Species Human (Homo sapiens) [TaxId:9606] [88605] (157 PDB entries)
    Uniprot P30685 25-300
    Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor
    Uniprot P30481 25-300
    Uniprot P01892 25-298
    Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
    Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor
  8. 784474Domain d2fz3a1: 2fz3 A:182-276 [134416]
    Other proteins in same PDB: d2fz3a2, d2fz3b1
    automatically matched to d1a1ma1

Details for d2fz3a1

PDB Entry: 2fz3 (more details), 1.9 Å

PDB Description: The role of T cell receptor alpha genes in directing human MHC restriction
PDB Compounds: (A:) HLA class I histocompatibility antigen, B-35 alpha chain

SCOP Domain Sequences for d2fz3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fz3a1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdtelvetrpagdrtf
qkwaavvvpsgeeqrytchvqheglpkpltlrwep

SCOP Domain Coordinates for d2fz3a1:

Click to download the PDB-style file with coordinates for d2fz3a1.
(The format of our PDB-style files is described here.)

Timeline for d2fz3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fz3a2
View in 3D
Domains from other chains:
(mouse over for more information)
d2fz3b1