Lineage for d2fyuj_ (2fyu J:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631382Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
    automatically mapped to Pfam PF05365
  5. 2631383Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)
  6. 2631384Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species)
    interacts with cytochrome c1 and ISP
  7. 2631395Species Cow (Bos taurus) [TaxId:9913] [81509] (20 PDB entries)
    Uniprot P00130
  8. 2631396Domain d2fyuj_: 2fyu J: [134404]
    Other proteins in same PDB: d2fyua1, d2fyua2, d2fyub1, d2fyub2, d2fyuc1, d2fyuc2, d2fyud1, d2fyud2, d2fyue1, d2fyue2, d2fyuf_, d2fyug_, d2fyuh_, d2fyui_, d2fyuk_
    automated match to d1be3j_
    complexed with fdn, fes, hem

Details for d2fyuj_

PDB Entry: 2fyu (more details), 2.26 Å

PDB Description: Crystal structure of bovine heart mitochondrial bc1 with jg144 inhibitor
PDB Compounds: (J:) Ubiquinol-cytochrome c reductase complex 7.2 kDa protein

SCOPe Domain Sequences for d2fyuj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fyuj_ f.23.14.1 (J:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
aptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkyen

SCOPe Domain Coordinates for d2fyuj_:

Click to download the PDB-style file with coordinates for d2fyuj_.
(The format of our PDB-style files is described here.)

Timeline for d2fyuj_: